Science, Volume 293John Michels (Journalist) American Association for the Advancement of Science, 2001 |
From inside the book
Results 1-3 of 79
Page 1786
John Michels (Journalist). Humans as the World's Greatest Evolutionary Force In addition to altering global ecology , technology and human population growth also affect evolutionary trajectories , dramatically accelerating evolutionary ...
John Michels (Journalist). Humans as the World's Greatest Evolutionary Force In addition to altering global ecology , technology and human population growth also affect evolutionary trajectories , dramatically accelerating evolutionary ...
Page 1794
... Human mdr1 1 Human mdr1 660 L.lac_lmrA 1 E.col msbA 63 H.inf_msbA 67 Human mdr1 89 Human mdr1 747 L.lac 1mrA 74 TM1 EC1 --MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTDRS ...
... Human mdr1 1 Human mdr1 660 L.lac_lmrA 1 E.col msbA 63 H.inf_msbA 67 Human mdr1 89 Human mdr1 747 L.lac 1mrA 74 TM1 EC1 --MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTDRS ...
Page 2470
... human bodies and body parts than for objects and object parts . The EBA is visible in the right occipitotemporal ... Human Body Paul E. Downing , 1 * Yuhong Jiang , 2 Miles Shuman , 2 Nancy Kanwisher2,3 Despite extensive evidence for ...
... human bodies and body parts than for objects and object parts . The EBA is visible in the right occipitotemporal ... Human Body Paul E. Downing , 1 * Yuhong Jiang , 2 Miles Shuman , 2 Nancy Kanwisher2,3 Despite extensive evidence for ...
Other editions - View all
Common terms and phrases
ABC transporters acid Action Employer active analysis and/or antibody apoptosis areas assay associated BAFF BAFF-R binding Biochemistry bioinformatics Biol Cancer cell biology cellular Center Chem chemistry clones College complex conorii curriculum vitae Department disease drug E-mail encouraged to apply Equal Opportunity Employer evolution experience FACULTY POSITION function funded galaxy gene expression genetics genome graduate human images Institute interactions interview after interview invites applications laboratory letters of reference Medical membrane ment mice microarray molecular biology molecules mouse mRNA MsbA Neuroscience ORFs pathway Ph.D Phys POSTDOCTORAL POSITION protein proteomics quantum quantum computer qubits receptors research interests research program Rickettsia Science scientific scientists Search Committee send curriculum vitae sequence Service Card signal signal transduction species structure successful candidate teaching tenure-track three letters three references tion transcription transfection tryptophan Univ University virus