Science, Volume 291John Michels (Journalist) American Association for the Advancement of Science, 2001 |
From inside the book
Results 1-3 of 81
Page 196
... human collection , individual GENEFILTERS microarrays are available which represent only named human genes or only genes that have been shown to be expressed in a particular human tissue . Rat and Mouse GENEFILTERS microarrays are also ...
... human collection , individual GENEFILTERS microarrays are available which represent only named human genes or only genes that have been shown to be expressed in a particular human tissue . Rat and Mouse GENEFILTERS microarrays are also ...
Page 561
John Michels (Journalist). The Most Complete Assembly of the Human Genome Celera's human assembly provides the most comprehensive and accurate view of the Human Genome . Using approximately 5x of Celera human sequence data combined with ...
John Michels (Journalist). The Most Complete Assembly of the Human Genome Celera's human assembly provides the most comprehensive and accurate view of the Human Genome . Using approximately 5x of Celera human sequence data combined with ...
Page 644
... Human GR Human TrxR C. elegans TrxR D. melanogaster Human GR Human TrxR C. elegans TrxR ----- ΜNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMV 40 --MYIKGNAVGGLKELKALKQDYLKEWLRDHTYDLIVIGGGSGGLAAAKEASRIGKKVAC 58 gene published by Candas et al ...
... Human GR Human TrxR C. elegans TrxR D. melanogaster Human GR Human TrxR C. elegans TrxR ----- ΜNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMV 40 --MYIKGNAVGGLKELKALKQDYLKEWLRDHTYDLIVIGGGSGGLAAAKEASRIGKKVAC 58 gene published by Candas et al ...
Other editions - View all
Common terms and phrases
AAAS accretion Action Employer activity analysis animal apoptosis applications areas ASSOCIATE Astrophys auxin Biochemistry bioinformatics black hole Cancer Cell Biology Center Chem chemistry clinical CO₂ College colloidal colloidal crystals curriculum vitae Department detected Director disease disk drug E-mail electron emission energy EPSP Equal Opportunity Employer experience fluorescence function funding gene genetic genomics graduate grammar human images Institute interactions laboratory Lett magnetar magnetic field Medical Medicine membrane ment mice microquasars migration Mladeč molecular biology molecules mutant neurons neutron star NPH-II observed olefin particles Ph.D Phys POSTDOCTORAL POSITION Professor protein receptor research program sample says Science scientific scientists send curriculum vitae sequence Service Card signal sporozoites stars structure successful candidate teaching Technology temperature tenure-track three references tion transgenic UHECR Univ University x-ray Yanomamo