Proceedings, American Philosophical Society (vol. 145, no. 4, 2001)American Philosophical Society |
From inside the book
Results 1-5 of 16
Page 384
... Landscapes , Funnels , Glasses , and Folding : From Metaphor to Software PETER G. WOLYNES . A Philomorph Looks at Foam DENIS WEAIRE .. Social Benefits of a Successful Biomedical Research Company : Merck P. ROY VAGELOS . . 555 564 575 ...
... Landscapes , Funnels , Glasses , and Folding : From Metaphor to Software PETER G. WOLYNES . A Philomorph Looks at Foam DENIS WEAIRE .. Social Benefits of a Successful Biomedical Research Company : Merck P. ROY VAGELOS . . 555 564 575 ...
Page 387
... LANDSCAPES , FUNNELS , GLASSES , AND FOLDING : FROM METAPHOR TO SOFTWARE DENIS WEAIRE Erasmus Smith Professor of Natural History and Experimental Biology Trinity College Dublin A PHILOMORPH LOOKS AT FOAM RICHARD J. O'CONNELL Professor ...
... LANDSCAPES , FUNNELS , GLASSES , AND FOLDING : FROM METAPHOR TO SOFTWARE DENIS WEAIRE Erasmus Smith Professor of Natural History and Experimental Biology Trinity College Dublin A PHILOMORPH LOOKS AT FOAM RICHARD J. O'CONNELL Professor ...
Page 554
... ( 1999 ) , 45 . 50. W. Gelletly , Cont . Phys . 42 ( 2001 ) , 285 ; see the volume Phil . Trans . Roy . Soc . ( London ) , 356 ( 1998 ) , ed . W. Gelletly . Landscapes , Funnels , Glasses , and Folding : From. 554 WILLIAM GELLETLY.
... ( 1999 ) , 45 . 50. W. Gelletly , Cont . Phys . 42 ( 2001 ) , 285 ; see the volume Phil . Trans . Roy . Soc . ( London ) , 356 ( 1998 ) , ed . W. Gelletly . Landscapes , Funnels , Glasses , and Folding : From. 554 WILLIAM GELLETLY.
Page 555
Landscapes , Funnels , Glasses , and Folding : From Metaphor to Software1 PETER G. WOLYNES Professor of Chemistry and Biochemistry University of California , San Diego O F ALL INTELLECTUALS , scientists are the most distrust- ful of ...
Landscapes , Funnels , Glasses , and Folding : From Metaphor to Software1 PETER G. WOLYNES Professor of Chemistry and Biochemistry University of California , San Diego O F ALL INTELLECTUALS , scientists are the most distrust- ful of ...
Page 556
... protein and how they are arranged and con- nected . Instead of a single path there is a " landscape " of possibilities 1poh : 1ptf : MFQQEVTITAPNGLHTRPAAQFVKEAKGFT MEKKEFHIVAETGIHARPATLLVOTASKFN 1poh : 1ptf : 556 PETER G. WOLYNES.
... protein and how they are arranged and con- nected . Instead of a single path there is a " landscape " of possibilities 1poh : 1ptf : MFQQEVTITAPNGLHTRPAAQFVKEAKGFT MEKKEFHIVAETGIHARPATLLVOTASKFN 1poh : 1ptf : 556 PETER G. WOLYNES.
Other editions - View all
Common terms and phrases
agricultural alpha decay AMERICAN PHILOSOPHICAL SOCIETY atomic nuclei award Bach Bach's biology Cambridge University Press capita cereal production Caricature century cereal cereal output cereal yield Charles Darwin context Copley Medal culture Darwin's theory decay DENIS WEAIRE drip-line Dyson E. A. Wrigley economic economists elements energy landscape Essay evolution evolutionary Figure foam foundations genius global gods Greek human important increase isotopes labour Letts London Malthus Malthus's Malthusian Maori Mectizan Merck Mill Mill's moral natural selection neutron neutron-rich nuclear astrophysics nuclear physics nuclear reactions nuclear species Orient orientalist Origin of Species particle philanthropy PHILOSOPHICAL SOCIETY VOL Phys poem political economy Poor Law population growth predicted Principle of Population problem protein proton radioactive ions recent region religion result role Royal Society rp-process sequence shell structure social stable nuclei tion treaty Wolynes world cereal world food Wrigley Yeats Zeus
Popular passages
Page 430 - Of all vulgar modes of escaping from the consideration of the effect of social and moral influences on the human mind, the most vulgar is that of attributing the diversities of conduct and character to inherent natural differences.
Page 431 - Hitherto it is questionable if all the mechanical inventions yet made have lightened the day's toil of any human being. They have enabled a greater population to live the same life of drudgery and imprisonment, and an increased number of manufacturers and others to make large fortunes.
Page 432 - I confess I am not charmed with the ideal of life held out by those who think that the normal state of human beings is that of struggling to get on; that the trampling, crushing, elbowing, and treading on each other's heels, which form the existing type of social life, are the most desirable lot of human kind, or anything but the disagreeable symptoms of one of the phases of industrial progress.
Page 399 - Did Quattrocento finger fashion it Hollow of cheek as though it drank the wind And took a mess of shadows for its meat?
Page 394 - Those that I fight I do not hate, Those that I guard I do not love ; My country is Kiltartan Cross, My countrymen Kiltartan 's poor, No likely end could bring them loss Or leave them happier than before. Nor law, nor duty bade me fight, Nor public men, nor cheering crowds, A lonely impulse of delight...
Page 434 - Important as the struggle for existence has been and even still is, yet as far as the highest part of man's nature is concerned there are other agencies more important. For the moral qualities are advanced, either directly or indirectly, much more through the effects of habit, the reasoning powers, instruction, religion, etc., than through natural selection...
Page 400 - Labour is blossoming or dancing where The body is not bruised to pleasure soul, Nor beauty born out of its own despair, Nor blear-eyed wisdom out of midnight oil.
Page 398 - Told of a harsh reproof, or trivial event That changed some childish day to tragedy — Told, and it seemed that our two natures blent Into a sphere from youthful sympathy...
Page 434 - Man, like every other animal, has no doubt advanced to his present high condition through a struggle for existence, consequent on his rapid multiplication ; and, if he is to advance still higher, it is to be feared that he must remain subject to a severe struggle...
Page 399 - Plato thought nature but a spume that plays Upon a ghostly paradigm of things; Solider Aristotle played the taws Upon the bottom of a king of kings; World-famous golden-thighed Pythagoras Fingered upon a fiddle-stick or strings What a star sang and careless Muses heard: Old clothes upon old sticks to scare a bird.